Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
L329647-1mg | 1mg | 1 | $459.90 |
Animal Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 22-167 aa
Product Name | Leptin (mouse), (recombinant) - ≥95%, high purity , CAS No.181030-10-4 |
---|---|
Synonyms | FLJ94114 | LEP | leptin (murine obesity homolog) | leptin (obesity homolog, mouse) | Leptin | OB | Obese protein | obese, mouse, homolog of | Obesity factor | OBOBS | obese |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
Biochemical and Physiological Mechanisms | May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic |
Bioactivity | Immobilized Recombinant Mouse LEPR (C-10His) at 5μg/ml (100 μl/well) can bind Recombinant Mouse Leptin Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse Leptin is 1.16 ng/ml. Loaded Recombinant Mouse LEPR (C-10His) on HIS1K Biosensor, can bind Recombinant Mouse Leptin with an affinity constant of 0.196 nM as determined in BLI assay. |
Endotoxin Concentration | <1.0 EU/μg |
Amino Acids | 22-167 aa |
Sequence | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Accession # | Q544U0 |
Predicted molecular weight | 16.1 KDa |
SDS-PAGE | 14 KDa, under reducing conditions. |
Reconstitution | Always centrifuge tubes before opening.Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20℃ long term (12 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
CAS | 181030-10-4 |