Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
np140196-10mg | 10mg | 5 | $79.90 | |
np140196-100mg | 100mg | 5 | $399.90 | |
np140196-1g | 1g | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $1,999.90 |
Product Name | Native Mouse Serum Albumin Protein |
---|---|
Synonyms | ALB | ALBU | Albumin | cell growth inhibiting protein 42 | DKFZp779N1935 | growth-inhibiting protein 20 | PRO0883 | PRO0903 | PRO1341 | serum albumin | Alb1 | Alb-1 | BCL002 |
Grade | Azide Free, Carrier Free |
Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE&HPLC) |
Biochemical and Physiological Mechanisms | Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in pl |
Species | Mouse |
Amino Acids | 25-608 aa |
Sequence | EAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFA KTCVADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNE CFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFY APELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRMKC SSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDL LECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPA DLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLA KKYEATLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYEKLGE YGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVE DYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTVDETYVPK EFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDD FAQFLDTCCKAADKDTCFSTEGPNLVTRCKDALA |
Conjugation | Unconjugated |
Accession # | P07724 |
Predicted molecular weight | 66 kDa |
Native Mouse Serum Albumin Protein (np140196) - SDS-PAGE
3 μg/lane of Native Mouse Serum Albumin Protein (np140196) was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 61.6 kDa under reducing conditions and 57.9 & 111.2 kDa under non-reducing conditions.
Shape | Lyophilized |
---|---|
Reconstitution | Reconstitute in pure water or normal saline or PBS to a concentration of 1%-10% according to requirement. |
Storage Temp | Store at 2-8°C |
Shipped In | Wet ice |
Stability And Storage | Store at 2-8 ℃. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | Sep 25, 2023 | np140196 |
![]() | Certificate of Analysis | Sep 25, 2023 | np140196 |
![]() | Certificate of Analysis | Sep 25, 2023 | np140196 |