Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp175916-10μg | 10μg | 10 | $139.90 | |
rp175916-50μg | 50μg | 2 | $299.90 | |
rp175916-100μg | 100μg | 1 | $399.90 | |
rp175916-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,999.90 |
Animal Free, >90% (SDS-PAGE), 293F cell, C-His tag, 1-394 aa
Product Name | Recombinant Bovine CD4 Protein, >90% (SDS-PAGE), high purity |
---|---|
Synonyms | T-cell surface glycoprotein CD4 | T-cell surface antigen T4/Leu-3 | CD4 |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
Product Description | Purity:> 90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description: CD4, also known as L3T4, T4, and W3/25, is an approximately 55 kDa type I transmembrane glycoprotein that is expressed predominantly on thymocytes and a subset of mature T lymphocytes. It is a standard phenotype marker for the identification of T cell populations. Mature feline CD4 consists of a 388 amino acid (aa) extracellular region containing four immunoglobulin-like domains, a 22 aa transmembrane segment, and a 40 aa cytoplasmic domain. Within the ECD, feline CD4 shares 70%, 58%, 50%, and 48% aa sequence identity with canine, human, mouse and rat CD4, respectively. CD4 is expressed along with CD8 on double positive T cells during their development in the thymus. Either CD4 or CD8 expression is then lost, giving rise to single positive (SP) CD4+ or CD8+ mature T cells. CD4+ SP cells, also known as T helper cells, further differentiate into multiple subsets of CD4+ cells including Th1, Th2, Th17, Tfh, and Treg cells which regulate humoral and cellular immunity. CD4 is reexpressed on circulating CD8+ T cells upon activation and contributes to their cytotoxic effector activity. In human, CD4 is additionally expressed on macrophages, neutrophils, monocytes, NK cells, and neurons and glial cells in the brain. Similar CD4 distribution between species cannot be assumed as demonstrated by its presence on macrophages in human and rat but not in mouse. CD4 binds directly to MHC class II molecules on antigen presenting cells. This interaction contributes to the formation of the immunological synapse which is focused around the TCR-MHC class II-antigenic peptide interaction. Palmitoylation of two cysteine residues in the cytoplasmic tail of CD4 promotes the localization of CD4 in lipid rafts and its ability to augment TCR signaling via activation of the tyrosine kinase Lck. CD4 also functions as a chemotactic receptor for IL-16 and, in human, as a coreceptor for the gp120 surface glycoprotein of HIV-1. |
Specifications & Purity | Animal Free, Carrier Free, Azide Free, Bioactive, ActiBioPure™, High performance, ≥90%(SDS-PAGE) |
Purity | >90% (SDS-PAGE) |
Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of NIH‑3T3 mouse embryonic fibroblast cells.The ED50for this effect is 0.1-0.5 μg/mL after a 1 hour incubation at37 °C.Optimal dilutions should be determined by each laboratory for each application. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | HEK293 |
Amino Acids | 1-394 aa |
Sequence | MGPGTSLRHLFLVLQLAMLPAGTQGKTVVLGEAGDKAELPCQASQKKNMVFSWKDSSQSNILGKRGLFFYKGTTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDKKTLEVELQVFRLTASSDTHVLLGQSLTLTLESPSGSNPSVQWKGPGDNNKRDVKSLSLAQVGLQDSGTWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEYENLSGELTWQLANGDSSSQSWVTFTVKNREVKVNKIHNDPKLLVGEKLPLRLTLPRTLPQHAGSGTLTLDLTKGKLQQKVKLVVMKVTKSPNSLTCEVLGPSPPKLTLNLKMGNQSMKGSNQPKLVTQPEPQAGMWQCLLSDNGKVLLEAKIEVLPSEFTQAWPKHHHHHH |
Protein Tag | C-His |
N-terminal Sequence | Ala22 |
Accession # | F1MJK4 |
Predicted molecular weight | 41.6 kDa |
SDS-PAGE | 38.8-53.9 kDa, under reducing conditions; 37.1-51.0 kDa, under non-reducing conditions |
Recombinant Bovine CD4 Protein (rp175916) - SDS-PAGE
3 μg/lane of Recombinant Bovine CD4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.8-53.9 kDa under reducing conditions and 37.1-51.0 kDa under non-reducing conditions.
Shape | Lyophilized |
---|---|
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | May 10, 2024 | rp175916 |
![]() | Certificate of Analysis | May 10, 2024 | rp175916 |
![]() | Certificate of Analysis | May 10, 2024 | rp175916 |