Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp175924-10μg | 10μg | ≥10 | $99.90 | |
rp175924-50μg | 50μg | 10 | $299.90 | |
rp175924-100μg | 100μg | 10 | $399.90 | |
rp175924-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, >95% (SDS-PAGE), 293F cell, C-His tag, 1-287 aa
Product Name | Recombinant Bovine CD64 Protein, >95% (SDS-PAGE), high purity |
---|---|
Synonyms | CD64 antigen | CD64 | CD64a | Fc fragment of IgG, high affinity Ia, receptor (CD64) | Fc gamma RI | FCG1 | Fc-gamma receptor I B2 | Fc-gamma RI | Fc-gamma RIA | FcgammaRIa | FcgRI | FCGR1 | FcgRIA | FCRI | FcRIA | FLJ18345 | high affinity Ia, receptor for |
Grade | Animal Free, Azide Free, Carrier Free |
Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
Specifications & Purity | Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
Purity | >95% (SDS-PAGE) |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | HEK293 |
Amino Acids | 1-287 aa |
Sequence | MWLIIALILGAPVAEQVDPTKAVITLKPPWVSVFQEENVTLLCEGPHRPGDTATQWFLNGTAIKTLAPRYSINSATFDDSGEYKCQTGLSMLSDPVQLEIHSDWLLLQVTSRVFTEGDPLALRCHAWKNMPVYKMLFYKDGKPFRFSSQDSEFTILQTNLSHNGIYHCSGERRRRYTSAGVSITIKELFPAPVLRTSFSSPHQEGNLVNLSCETKLPSEKPGQQLYFSFYVGNKTLISRTTSSEYQTFIAKKEDRRLYWCEAATGDGNLIKRSPELELPVLGLQSTTHHHHHH |
Protein Tag | C-His |
Accession # | Q9MZT0 |
Predicted molecular weight | 33.5 kDa |
SDS-PAGE | 37.7-52.3 kDa, under reducing conditions; 36.7-51.3 kDa, under non-reducing conditions |
Recombinant Bovine CD64 Protein (rp175924) - SDS-PAGE
3 μg/lane of Recombinant Bovine CD64 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.7-52.3 kDa under reducing conditions and 36.7-51.3 kDa under non-reducing conditions.
Shape | Lyophilized |
---|---|
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | Mar 22, 2024 | rp175924 |
![]() | Certificate of Analysis | Mar 22, 2024 | rp175924 |
![]() | Certificate of Analysis | Mar 22, 2024 | rp175924 |
![]() | Certificate of Analysis | Mar 22, 2024 | rp175924 |
![]() | Certificate of Analysis | Mar 08, 2024 | rp175924 |