Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp143912-10μg | 10μg | ≥10 | $139.90 | |
rp143912-50μg | 50μg | 8 | $369.90 | |
rp143912-100μg | 100μg | 3 | $589.90 | |
rp143912-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,599.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F, His tag, 29-246 aa
Product Name | Recombinant Human CD276 Protein, >95% (SDS-PAGE), high purity |
---|---|
Synonyms | B7H3 | B7-H3 | B7H34Ig-B7-H3 | B7-H3B7 homolog 3 | CD276 antigen | CD276 molecule | CD276 | Costimulatory molecule | B7RP-2 | 4Ig-B7-H3 |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
Product Description | Purity |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
Purity | >95% (SDS-PAGE) |
Bioactivity | 1、Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL. 2、Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear range of 1 - 4 ng/mL (EC50:4.3 ng/mL). |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | HEK293 |
Species | Human |
Amino Acids | 29-246 aa |
Sequence | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHH |
Protein Tag | C-His |
Accession # | Q5ZPR3-2 |
Predicted molecular weight | 23 kDa |
SDS-PAGE | 38.9 kDa, under reducing conditions; 37.0 kDa, under non-reducing conditions. |
Recombinant Human CD276 Protein (rp143912) - Protein Bioactivity
Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL.
Recombinant Human CD276 Protein (rp143912) - Protein Bioactivity
Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear range of 1 - 4 ng/mL (EC₅₀:4.3 ng/mL).
Recombinant Human CD276 Protein (rp143912) - SDS-PAGE
3 μg/lane of Recombinant Human CD276 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.9 kDa under reducing conditions and 37.0 kDa under non-reducing conditions.
Recombinant Human CD276 Protein (rp143912) - ELISA
Immobilized Recombinant Human CD276 Protein ( rp143912) at 1.0 μg/mL can bind Mirzotamab (anti-CD276) (Ab182952) with the EC₅₀ of 28.84 ng/mL.
Shape | Lyophilized |
---|---|
Reconstitution | Reconstitute in sterile H2O to a concentration of 0.1-0.5 mg/ml. |
Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at ﹣20~﹣80℃ for more than 1 year. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | Dec 13, 2023 | rp143912 |
![]() | Certificate of Analysis | Dec 13, 2023 | rp143912 |
![]() | Certificate of Analysis | Dec 13, 2023 | rp143912 |