Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp170413-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
rp170413-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp170413-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $219.90 | |
rp170413-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,289.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 16-155 aa
Product Name | Recombinant Human FGF acidic/FGF1 Protein |
---|---|
Synonyms | AFGF | alpha | alpha-ECGF | beta-ECGF | ECGF | ECGFB | ECGF-betaAcidic fibroblast growth factor | endothelial cell growth factor, beta | FGF acidic | FGF-1 | FGFABeta-endothelial cell growth factor | FGF-alpha | fibroblast growth factor 1 (acidic) | GLIO7 |
Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
Product Description | Protein Function: |
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE) |
Bioactivity | Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED50 for this effect is typically 0.28 ng/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | E. coli |
Amino Acids | 16-155 aa |
Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Protein Tag | No tag |
Accession # | P05230 |
Predicted molecular weight | 15.9 kDa |
SDS-PAGE | 14.3 kDa, under reducing conditions; 14.2 kDa, under non-reducing conditions |
Recombinant Human FGF acidic/FGF1 Protein (rp170413) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED₅₀ for this effect is typically 0.28 ng/mL.
Recombinant Human FGF acidic/FGF1 Protein (rp170413) - SDS-PAGE
3 μg/lane of Recombinant Human FGF acidic/FGF1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.3 kDa under reducing conditions and 14.2 kDa under non-reducing conditions.
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Starting at $69.90