Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp156010-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
rp156010-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $159.90 | |
rp156010-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
rp156010-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $899.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, N-His tag, 134-288 aa
Product Name | Recombinant Human FGF basic Protein, >95% (SDS-PAGE), high purity |
---|---|
Synonyms | Basic fibroblast growth factor | Basic fibroblast growth factor bFGF | BFGF | FGF 2 | FGF B | FGF-2 | Fgf2 | FGF2 basic | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (basic) | Fibroblast growth factor 2 | Fibroblast growth factor, basic | HBGF 2 | HBGF |
Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance |
Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
Purity | >95% (SDS-PAGE) |
Bioactivity | Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.44 ng/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | E. coli |
Amino Acids | 134-288 aa |
Sequence | MGSSHHHHHHSSGLVPRGSHMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Protein Tag | N-His |
Accession # | P09038 |
Predicted molecular weight | 19.4 kDa |
SDS-PAGE | 19.0 kDa, under reducing conditions; 19.0 kDa, under non-reducing conditions |
Recombinant Human FGF basic Protein (rp156010) - Biological activity
Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED₅₀ for this effect is 0.44 ng/mL.
Recombinant Human FGF basic Protein (rp156010) - SDS-PAGE
3 μg/lane of Recombinant Human FGF basic Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.0 kDa.
Shape | Lyophilized |
---|---|
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Starting at $189.90
Starting at $59.90