Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp176705-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
rp176705-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
rp176705-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
rp176705-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His, 1101-1367 aa
Product Name | Recombinant Human IGF-I R/IGF1R Protein |
---|---|
Synonyms | CD221 antigen | CD221 | EC 2.7.10 | EC 2.7.10.1 | IGF1R | IGF-1R | IGF-I R | IGF-I receptor | IGFIR | IGF-IR | IGFR | insulin-like growth factor 1 receptor | Insulin-like growth factor I receptor | JTK13 | MGC142170 | MGC142172 | MGC18216 | soluble IGF1R |
Grade | Carrier Free |
Specifications & Purity | Carrier Free, ≥90%(SDS-PAGE), See COA |
Biochemical and Physiological Mechanisms | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthe |
Amino Acids | 1101-1367 aa |
Sequence | MHHHHHHNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
Accession # | P08069 |
Predicted molecular weight | 31.0 kDa |
SDS-PAGE | 34.2 kDa, under reducing conditions |
Recombinant Human IGF-I R/IGF1R Protein (rp176705) - SDS-PAGE
3 μg/lane of Recombinant Human IGF-I R/IGF1R Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 34.2 kDa.
Concentration | See COA |
---|---|
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. Upon reconstitution, it is recommended to aliquot. |