Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp147628-10μg | 10μg | 9 | $389.90 | |
rp147628-50μg | 50μg | 4 | $1,429.90 | |
rp147628-100μg | 100μg | 1 | $2,289.90 | |
rp147628-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $16,499.90 |
Animal Free, >90% (SDS-PAGE), Active, HEK293, C-His tag, 20-365 aa
Product Name | Recombinant Human IL-6R Protein, >90% (SDS-PAGE), high purity |
---|---|
Synonyms | CD126 | gp80 | IL-6 R alpha | IL6Q | IL6R alpha | IL-6R alpha | IL6R | IL-6R-1 | IL6RA | IL-6Ra | IL6RQ | interleukin 6 receptor | HIES5 | IL-6R | IL-1Ra | IL6QTL |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
Product Description | Function: |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥90%(SDS-PAGE) |
Purity | >90% (SDS-PAGE) |
Bioactivity | 1. Immobilized Recombinant Human IL-6 Protein at 2 μg/mL can bind Recombinant Human IL-6R Protein (rp147628) the EC50 is 8.0 - 24.0 ng/mL. 2. Measured by its ability to enhance the IL-6 activity on M1 mouse myeloid leukemia cells. The ED50 for this effect is typically 10.0 - 60.0 ng/mL.3. Using the Octet RED System, the affinity constant (Kd) of Recombinant Human IL-6R Protein (rp147628) bound Anti-IL6R Antibody was 0.1 nM. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | HEK293 |
Species | Human |
Amino Acids | 20-365 aa |
Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPAHHHHHHHHHH |
Protein Tag | C-His |
Accession # | P08887 |
Predicted molecular weight | 40 kDa |
SDS-PAGE | 71.1 kDa, under reducing conditions; 68.4 kDa, under non-reducing conditions. |
Recombinant Human IL-6R Protein (rp147628) - Protein Bioactivity
Immobilized Recombinant Human IL-6 Protein at 2 μg/mL can bind Recombinant Human IL-6R Protein (rp147628) the EC₅₀ is 8.0 - 24.0 ng/mL.
Recombinant Human IL-6R Protein (rp147628) - Protein Bioactivity
Measured by its ability to enhance the IL-6 activity on M1 mouse myeloid leukemia cells. The ED₅₀ for this effect is typically 10.0 - 60.0 ng/mL.
Recombinant Human IL-6R Protein (rp147628) - BLI Assay
Using the Octet RED System, the affinity constant (Kd) of Recombinant Human IL-6R Protein (rp147628) bound Anti-IL6R Antibody was 0.1 nM.
Recombinant Human IL-6R Protein (rp147628) - SDS-PAGE
3 μg/lane of Recombinant Human IL-6R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 71.1 kDa under reducing conditions and 68.4 kDa under non-reducing conditions.
Shape | Lyophilized |
---|---|
Reconstitution | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Samples are stable for twelve months from date of receipt at -20℃ to -80℃. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | May 24, 2024 | rp147628 |
![]() | Certificate of Analysis | May 24, 2024 | rp147628 |
![]() | Certificate of Analysis | May 24, 2024 | rp147628 |
Starting at $139.90