Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp148028-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp148028-25μg | 25μg | 3 | $299.90 | |
rp148028-50μg | 50μg | 1 | $499.90 | |
rp148028-100μg | 100μg | 1 | $799.90 | |
rp148028-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,399.90 |
Animal Free, >95% SDS-PAGE, Active, E.coli, No tag, 32-194aa
Product Name | Recombinant Human KGF/FGF-7 Protein, >95% SDS-PAGE, high purity |
---|---|
Synonyms | FGF7 | FGF-7 | fibroblast growth factor 7 | HBGF-7 | HBGF7 | Heparin-binding growth factor 7 | keratinocyte growth factor | KGF | fibroblast growth factor 7 (keratinocyte growth factor) | FGF-7 | HBGF-7 | Heparin-binding growth factor 7 | Keratinocyte gro |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
Purity | >95% SDS-PAGE |
Bioactivity | Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cell. The ED₅₀ for this effect is typically <1.38 ng/mL |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | E.coli |
Species | Human |
Amino Acids | 32-194 aa |
Sequence | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDK RGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKK ECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT |
Protein Tag | No tag |
Protein Length | Full length protein |
Accession # | P21781 |
Source | Recombinant |
Predicted molecular weight | 19 kDa |
Recombinant Human KGF/FGF-7 Protein (rp148028)-Protein Bioactivity
Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cell. The ED₅₀ for this effect is typically <1.38ng/mL.
Recombinant Human KGF/FGF-7 Protein(rp148028)-SDS-PAGE
3μg/lane of Recombinant Human KGF was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 19kDa.
Shape | lyophilized |
---|---|
Reconstitution | After receiving lyophilized powder protein, centrifuge first, and then redissolve with deionized water to purposed concentration. |
Storage Temp | Store at -20°C |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Stable for 12 months from the date of receipt of the product under proper storage andhandling conditions. Avoid repeated freeze-thaw cycles. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | Apr 06, 2023 | rp148028 |
![]() | Certificate of Analysis | Apr 06, 2023 | rp148028 |
![]() | Certificate of Analysis | Apr 06, 2023 | rp148028 |
Starting at $189.90
1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] [10.1021/op500134e] |
2. Aaronson, S A SA and 8 more authors.. (1991) Keratinocyte growth factor. A fibroblast growth factor family member with unusual target cell specificity.. Annals of the New York Academy of Sciences, [PMID:1664700] |
3. Finch, P W PW, Rubin, J S JS, Miki, T T, Ron, D D and Aaronson, S A SA.. (1989) Human KGF is FGF-related with properties of a paracrine effector of epithelial cell growth.. Science (New York, N.Y.), (18): [PMID:2475908] |
4. Rubin, J S JS and 5 more authors.. (1989) Purification and characterization of a newly identified growth factor specific for epithelial cells.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2915979] |
5. Beer, Hans-Dietmar HD and 6 more authors.. (2005) The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair.. Oncogene, (11): [PMID:15806171] |
6. Zody, Michael C MC and 68 more authors.. (2006) Analysis of the DNA sequence and duplication history of human chromosome 15.. Nature, (30): [PMID:16572171] |
7. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |