Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp179796-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
rp179796-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
rp179796-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $309.90 | |
rp179796-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 1-147 aa
Product Name | Recombinant Human/Mouse/Rat UbcH5c/UBE2D3 Protein |
---|---|
Synonyms | E2(17)KB3 | MGC43926 | MGC5416 | PRO2116 | UB2D3_HUMAN | UBC 4/5 | UBC4/5 | UBC4/5 homolog yeast | UBC4/5, S. cerevisiae, homolog of | UBCH 5C | UBCH5C | Ube2d3 | Ubiquitin carrier protein | Ubiquitin carrier protein D3 | Ubiquitin conjugating enzyme E2 1 |
Grade | Carrier Free |
Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), See COA |
Biochemical and Physiological Mechanisms | Ubiquitin-conjugating Enzyme H5c (UbcH5c), also known as Ubiquitin-conjugating Enzyme E2D 3 (UBE2D3), is a member of the yeast Ubc4/5 family of Ubiquitin-conjugating (E2) enzymes. Human UbcH5c/UBE2D3 has a predicted molecular weight of 17 kDa and shares 8 |
Bioactivity | Testing in progress |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | E. coli |
Amino Acids | 1-147 aa |
Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Protein Tag | No tag |
Accession # | P61077 |
Predicted molecular weight | 16.7 kDa |
SDS-PAGE | 14.5 kDa, under reducing conditions; 13.8 kDa & 14.5 kDa & 29.9 kDa & 31.9 kDa, under non-reducing conditions |
Recombinant Human/Mouse/Rat UbcH5c/UBE2D3 Protein (rp179796) - SDS-PAGE
3 μg/lane of Recombinant Human/Mouse/Rat UbcH5c/UBE2D3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.5 kDa under reducing conditions and 13.8 & 14.5 & 29.9 & 31.9 kDa under non-reducing conditions.
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Concentration | See COA |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |