Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp153094-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $59.90 | |
rp153094-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
rp153094-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $219.90 | |
rp153094-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,539.90 |
Carrier Free, >92% (SDS-PAGE), Active, 293F, N-His tag,109-318 aa
Product Name | Recombinant Human VCAM1 Protein, >92% (SDS-PAGE), high purity |
---|---|
Synonyms | CD106 | CD106 antigen | DKFZp779G2333 | INCAM-100 | L1CAM | MGC99561 | vascular cell adhesion molecule 1 | vascular cell adhesion protein 1 | V-CAM 1 | VCAM1 | VCAM-1 |
Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free |
Product Description | Background: VCAM-1, also known as CD106, is an immunoglobulin (Ig)-like adhesion molecule that is mainly expressed in endothelial cells and other cell types including macrophages, dendritic cells, neurons, smooth muscle cells, fibroblasts, and oocytes. It plays a critical role in inflammation by recruiting leukocytes to acute and chronic inflammation sites. Alternatively-spliced forms are known to occur, but the most common form is a type I transmembrane protein with a 674 aa extracellular domain (ECD) that includes seven C2-type immunoglobulin domains, a 22 aa transmembrane segment, and a 19 amino acid (aa) cytoplasmic tail. Within the ECD, human VCAM-1 shares 75% and 76% aa sequence identity with the mouse and rat VCAM-1, respectively. VCAM-1 binds to leukocyte integrins alpha 4 beta 1 (VLA-4) and alpha 4 beta 7. During the inflammatory adhesion mechanism, activated integrins halt rolling leukocytes and attach them firmly to the vascular endothelium. The VCAM-1:VLA-4/ alpha 4 beta 7 interaction is also thought to be involved in the extravasation of white blood cells through the blood vessel wall to sites of inflammation. ELISA techniques have shown that detectable levels of soluble VCAM-1 are present in the biological fluids of apparently normal individuals, but elevated levels of serum VCAM-1 are indicative of future Atrial Fibrillation incident as well as liver disease. Tumor cells use overexpression of VCAM-1 as means of escaping immune surveillance. Post-translational modifications: Sialoglycoprotein. Function: Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
|
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥92%(SDS-PAGE) |
Purity | >92% (SDS-PAGE) |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized recombinant human ITGa4 at 2 μg/ml(100 μl/well) can bind Human VCAM-1, the ED50 for this effect is 0.261 µg/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | HEK293 |
Species | Human |
Amino Acids | 109-318 aa |
Sequence | HHHHHHGTDIGSEFQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEIS |
Protein Tag | N-His |
Protein Length | Protein fragment |
Conjugation | Unconjugated |
Accession # | P19320,NP_001069.1 |
Source | Recombinant |
Predicted molecular weight | 25.0 kDa |
SDS-PAGE | 30 kDa,under reducing conditions |
Recombinant Human VCAM1 Protein (rp153094)-Protein Bioactivity
The binding activity of recombinant human VCAM-1 and recombinant human ITGa4. The ED₅₀
for this effect is <
0.261ug/mL.
Recombinant Human VCAM1 Protein (rp153094)-SDS-PAGE
3μg/lane of Recombinant Human VCAM1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 31.9 kDa.
Shape | Lyophilized |
---|---|
Reconstitution | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 months. |
Find and download the COA for your product by matching the lot number on the packaging.
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
![]() | Certificate of Analysis | Jun 12, 2023 | rp153094 |
![]() | Certificate of Analysis | Jun 12, 2023 | rp153094 |
![]() | Certificate of Analysis | Jun 12, 2023 | rp153094 |