Recombinant Mouse M-CSF Protein, >90% SDS-PAGE, high purity

Features and benefits
  • Expression System: HEK293
  • Accession #: P07141
  • Protein Tag: N-His
  • Bioactivity: Recombinant Mouse M-CSF Protein has been identified as an interactor of M-CSF, a binding ELISA assay was conducted to detect the interaction of recombinant mouse M-CSF and recombinant mouse MCSFR.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp154365
Grouped product items
SKUSizeAvailabilityPrice Qty
rp154365-100μg
100μg
1
$1,099.90

>90% SDS-PAGE, Active, 293F, His-tag, 33-262 aa

Basic Description

Product NameRecombinant Mouse M-CSF Protein, >90% SDS-PAGE, high purity
SynonymsColony stimulating factor 1 | Colony stimulating factor 1 (macrophage) | Colony stimulating factor macrophage specific CSF 1 | CSF-1 | CSF1 | CSF1_HUMAN | Csfm Lanimostim | M CSF | M-CSF | Macrophage colony stimulating factor | Macrophage Colony Stimulati
GradeActiBioPure™, Azide Free, Bioactive, Carrier Free
Product Description

Purity

≥ 95% SDS-PAGE. Purified using standard chromatographical techniques.


Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.


Post-translational

Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate. Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.

Specifications & PurityActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥90%(SDS-PAGE)
Purity>90% SDS-PAGE
BioactivityRecombinant Mouse M-CSF Protein has been identified as an interactor of M-CSF, a binding ELISA assay was conducted to detect the interaction of recombinant mouse M-CSF and recombinant mouse MCSFR.
Endotoxin Concentration<1.0 EU/μg
Expression SystemHEK293
SpeciesMouse
Amino Acids33-262 aa
SequenceKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQ ELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYP KATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Protein TagN-His
Protein LengthProtein fragment
Accession #P07141
SourceRecombinant
Predicted molecular weight29.7kDa
SDS-PAGE46.7-64.6 kDa, under reducing conditions; 76.9-119.0 kDa, under non-reducing conditions.

Images

Recombinant Mouse M-CSF Protein (rp154365)-Protein Bioactivity
Recombinant Mouse M-CSF Protein has been identified as an interactor of M-CSF, a binding ELISA assay was conducted to detect the interaction of recombinant mouse M-CSF and recombinant mouse MCSFR.

Recombinant Mouse M-CSF Protein (rp154365)-SDS-PAGE
8μg/lane of Recombinant Mouse M-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing the band at 46.7-64.6 kDa under reducing conditions and 76.9-119.0 kDa under non-reducing conditions.

Product Specifications

ShapeLyophilized
ReconstitutionReconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex
Storage TempStore at -20°C
Shipped InIce chest + Ice pads
Stability And StorageStore at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. This product is an active protein and may elicit a biological response in vivo, handle with caution.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDateItem
ZJ24F0404266Certificate of AnalysisApr 11, 2024 rp154365
ZJ24F0404265Certificate of AnalysisApr 11, 2024 rp154365
ZJ24F0404264Certificate of AnalysisApr 11, 2024 rp154365
ZJ23F0500259Certificate of AnalysisJun 12, 2023 rp154365
ZJ23F0600283Certificate of AnalysisJun 12, 2023 rp154365

Specifications

Solution Calculators

Reviews

Customer Reviews