The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
CA4
Description | Carbonic anhydrase 4 |
---|
Gene and Protein Information
Gene ID | 762 |
Uniprot Accession IDs | P22748 B4DQA4 Q6FHI7 |
Ensembl ID | ENSG00000167434 |
Symbol | CAIV Car4 RP17 |
Chromosome | 17 |
Family | Belongs to the alpha-carbonic anhydrase family. |
Sequence | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 454807 | CA4 | carbonic anhydrase 4 | 9598 | VGNC:9136 | OMA, EggNOG |
Mouse | 12351 | Car4 | carbonic anhydrase 4 | 10090 | MGI:1096574 | Inparanoid, OMA, EggNOG |
Rat | 29242 | Car4 | carbonic anhydrase 4 | 10116 | RGD:2242 | OMA, EggNOG |
Dog | 480591 | CA4 | carbonic anhydrase 4 | 9615 | VGNC:38612 | Inparanoid, OMA, EggNOG |
Horse | 100071384 | CA4 | carbonic anhydrase 4 | 9796 | VGNC:15965 | Inparanoid, OMA, EggNOG |
Cow | 280741 | CA4 | carbonic anhydrase 4 | 9913 | VGNC:26654 | Inparanoid, OMA, EggNOG |
Pig | 100511956 | CA4 | carbonic anhydrase 4 | 9823 | | Inparanoid, OMA, EggNOG |
Chicken | 417647 | CA4 | carbonic anhydrase 4 | 9031 | CGNC:3991 | Inparanoid, OMA, EggNOG |
Anole lizard | 103280438 | ca4 | carbonic anhydrase 4 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100489625 | ca4 | carbonic anhydrase IV | 8364 | XB-GENE-5952677 | OMA, EggNOG |
Zebrafish | 555196 | ca4a | carbonic anhydrase IV a | 7955 | ZDB-GENE-080204-85 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|