The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
TIA1
Description | Nucleolysin TIA-1 isoform p40 |
---|
Gene and Protein Information
Gene ID | 7072 |
Uniprot Accession IDs | P31483 Q53SS9 Q96B58 |
Ensembl ID | ENSG00000116001 |
Symbol | WDM TIA-1 |
Chromosome | 2 |
Sequence | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 459303 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9598 | | OMA, EggNOG |
Macaque | 702366 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 21841 | Tia1 | cytotoxic granule-associated RNA binding protein 1 | 10090 | MGI:107914 | Inparanoid, OMA, EggNOG |
Rat | 312510 | Tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 10116 | RGD:1305742 | Inparanoid, OMA |
Dog | 610625 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9615 | VGNC:47363 | Inparanoid, OMA, EggNOG |
Horse | | TIA1 | TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802] | 9796 | | OMA, EggNOG |
Cow | 538533 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9913 | VGNC:35858 | Inparanoid, OMA, EggNOG |
Opossum | 100032808 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 13616 | | Inparanoid, EggNOG |
Chicken | 771327 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9031 | | Inparanoid, OMA, EggNOG |
Xenopus | 394890 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 8364 | XB-GENE-1002876 | Inparanoid, OMA, EggNOG |
Zebrafish | 793165 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 7955 | ZDB-GENE-030131-1506 | Inparanoid, OMA, EggNOG |
C. elegans | 173967 | tiar-1 | TIA-1/TIAL RNA binding protein homolog | 6239 | | OMA, EggNOG |
S.cerevisiae | 855716 | PUB1 | Pub1p | 4932 | S000004961 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|