JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

Home
Targets(Human)
CA5A

CA5A

Description	Carbonic anhydrase 5A, mitochondrial

Gene and Protein Information

Gene ID	763
Uniprot Accession IDs	P35218 B2RPF2
Ensembl ID	ENSG00000174990
Symbol	CA5 CA5 CAV CAVA CA5AD GS1-21A4.1
Chromosome	16
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	468095	CA5A	carbonic anhydrase 5A	9598	VGNC:9075	OMA, EggNOG
Mouse	12352	Car5a	carbonic anhydrase 5a, mitochondrial	10090	MGI:101946	Inparanoid, OMA, EggNOG
Rat	54233	Car5a	carbonic anhydrase 5A	10116	RGD:2243	Inparanoid, OMA, EggNOG
Dog	609174	CA5A	carbonic anhydrase 5A	9615	VGNC:53312	Inparanoid, OMA, EggNOG
Horse	100070642	CA5A	carbonic anhydrase 5A	9796	VGNC:49304	Inparanoid, OMA, EggNOG
Cow	515359	CA5A	carbonic anhydrase 5A	9913	VGNC:50002	Inparanoid, OMA, EggNOG
Opossum	100025662	CA5A	carbonic anhydrase 5A	13616		Inparanoid, EggNOG
Platypus		CA5A	carbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377]	9258		OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]