The store will not work correctly when cookies are disabled.
CD3D
Description | T-cell surface glycoprotein CD3 delta chain |
---|
Gene and Protein Information
Gene ID | 915 |
Uniprot Accession IDs | P04234 A8MVP6 |
Ensembl ID | ENSG00000167286 |
Symbol | T3D T3D IMD19 CD3-DELTA |
Chromosome | 11 |
Sequence | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 451584 | CD3D | CD3d molecule | 9598 | VGNC:6481 | OMA, EggNOG |
Macaque | 699582 | CD3D | CD3d molecule | 9544 | | Inparanoid, EggNOG |
Mouse | 12500 | Cd3d | CD3 antigen, delta polypeptide | 10090 | MGI:88331 | Inparanoid, OMA, EggNOG |
Rat | 25710 | Cd3d | CD3d molecule | 10116 | RGD:2304 | Inparanoid, OMA, EggNOG |
Dog | 479419 | CD3D | CD3d molecule | 9615 | VGNC:38954 | Inparanoid, OMA, EggNOG |
Horse | 100062931 | CD3D | CD3d molecule | 9796 | VGNC:16263 | Inparanoid, OMA, EggNOG |
Cow | 281053 | CD3D | CD3d molecule | 9913 | VGNC:27028 | Inparanoid, OMA, EggNOG |
Pig | 396661 | CD3D | CD3d molecule | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100031472 | CD3D | CD3d molecule | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 396518 | CD3D | CD3d molecule | 9031 | CGNC:49849 | OMA, EggNOG |
Xenopus | 100216101 | cd3g | CD3g molecule | 8364 | XB-GENE-480422 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|