The store will not work correctly when cookies are disabled.
CD52
Description | CAMPATH-1 antigen |
---|
Gene and Protein Information
Gene ID | 1043 |
Uniprot Accession IDs | P31358 Q5T138 Q9BW46 |
Ensembl ID | ENSG00000169442 |
Symbol | CDW52 HE5 HE5 CDW52 EDDM5 |
Chromosome | 1 |
Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 736829 | CD52 | CD52 molecule | 9598 | VGNC:5012 | OMA, EggNOG |
Macaque | 714429 | CD52 | CD52 molecule | 9544 | | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|