The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
UBE2D3
| Description | Ubiquitin-conjugating enzyme E2 D3 |
|---|
Gene and Protein Information
| Gene ID | 7323 |
|---|
| Uniprot Accession IDs | P61077 A6NJ93 A6NJB1 A6NM99 P47986 Q6IB88 Q6NXS4 Q8N924 |
|---|
| Ensembl ID | ENSG00000109332 |
|---|
| Symbol | UBC5C UBCH5C UBC4/5 UBCH5C E2(17)KB3 |
|---|
| Chromosome | 4 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
|---|
| Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 66105 | Ube2d3 | ubiquitin-conjugating enzyme E2D 3 | 10090 | MGI:1913355 | Inparanoid, OMA |
| Rat | 81920 | Ube2d3 | ubiquitin-conjugating enzyme E2D 3 | 10116 | RGD:619912 | Inparanoid, OMA |
| Chicken | 422713 | UBE2D3 | ubiquitin conjugating enzyme E2 D3 | 9031 | CGNC:51809 | Inparanoid, OMA |
| C. elegans | 178006 | let-70 | Ubiquitin-conjugating enzyme E2 2 | 6239 | | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
ligase / Ubiquitin-conjugating enzyme E2 D3
DTO Classes protein /
Enzyme /
Ligase / Ubiquitin-conjugating enzyme E2 D3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
