The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
IGF1
Description | Insulin-like growth factor I |
---|
Gene and Protein Information
Gene ID | 3479 |
Uniprot Accession IDs | P05019 B2RWM7 E9PD02 P01343 Q14620 IGF-I |
Ensembl ID | ENSG00000017427 |
Symbol | IBP1 IGF MGF IGFI IGF-I |
Chromosome | 12 |
Family | Belongs to the insulin family. |
Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 741055 | IGF1 | insulin like growth factor 1 | 9598 | VGNC:5427 | OMA, EggNOG |
Macaque | 698444 | IGF1 | insulin like growth factor 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 16000 | Igf1 | insulin-like growth factor 1 | 10090 | MGI:96432 | Inparanoid, OMA, EggNOG |
Rat | 24482 | Igf1 | insulin-like growth factor 1 | 10116 | RGD:2868 | Inparanoid, OMA, EggNOG |
Dog | 610255 | IGF1 | insulin like growth factor 1 | 9615 | VGNC:41895 | Inparanoid, OMA, EggNOG |
Horse | 100034198 | IGF1 | insulin like growth factor 1 | 9796 | VGNC:18967 | Inparanoid, OMA, EggNOG |
Cow | 281239 | IGF1 | insulin like growth factor 1 | 9913 | VGNC:30076 | Inparanoid, OMA, EggNOG |
Pig | 397491 | IGF1 | insulin like growth factor 1 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100021295 | IGF1 | insulin like growth factor 1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100075905 | IGF1 | insulin like growth factor 1 | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 418090 | IGF1 | insulin like growth factor 1 | 9031 | CGNC:9671 | Inparanoid, OMA, EggNOG |
Anole lizard | 100566682 | igf1 | insulin like growth factor 1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100486334 | igf1 | insulin like growth factor 1 | 8364 | XB-GENE-480239 | Inparanoid, OMA, EggNOG |
Zebrafish | 114433 | igf1 | insulin-like growth factor 1 | 7955 | ZDB-GENE-010607-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|