The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
FGF2
Description | Fibroblast growth factor 2 |
---|
Gene and Protein Information
Gene ID | 2247 |
Uniprot Accession IDs | P09038 A4LBB8 O00527 P78443 Q16443 Q5PY50 Q7KZ11 Q7KZ72 Q9UC54 Q9UCS5 Q9UCS6 FGF-2 |
Ensembl ID | ENSG00000138685 |
Symbol | FGFB BFGF FGFB FGF-2 HBGF-2 |
Chromosome | 4 |
Family | Belongs to the heparin-binding growth factors family. |
Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 641462 | FGF2 | fibroblast growth factor 2 | 9598 | | Inparanoid, OMA |
Macaque | | FGF2 | fibroblast growth factor 2 [Source:HGNC Symbol;Acc:HGNC:3676] | 9544 | | Inparanoid, EggNOG |
Mouse | 14173 | Fgf2 | fibroblast growth factor 2 | 10090 | MGI:95516 | Inparanoid, EggNOG |
Rat | 54250 | Fgf2 | fibroblast growth factor 2 | 10116 | RGD:2609 | Inparanoid, EggNOG |
Dog | 403857 | FGF2 | fibroblast growth factor 2 | 9615 | VGNC:40847 | Inparanoid, OMA, EggNOG |
Cow | 281161 | FGF2 | fibroblast growth factor 2 | 9913 | | Inparanoid, EggNOG |
Opossum | 619384 | FGF2 | fibroblast growth factor 2 | 13616 | | Inparanoid, EggNOG |
Xenopus | 550087 | fgf2 | fibroblast growth factor 2 | 8364 | XB-GENE-487002 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|