The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
FKBP1B
Description | Peptidyl-prolyl cis-trans isomerase FKBP1B |
---|
Gene and Protein Information
Gene ID | 2281 |
Uniprot Accession IDs | P68106 Q13664 Q16645 Q53TM2 Q9BQ40 PPIase FKBP1B |
Ensembl ID | ENSG00000119782 |
Symbol | FKBP12.6 FKBP1L FKBP9 OTK4 OTK4 FKBP1L PKBP1L PPIase FKBP12.6 |
Chromosome | 2 |
Family | Belongs to the FKBP-type PPIase family. FKBP1 subfamily. |
Sequence | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 741549 | FKBP1B | FK506 binding protein 1B | 9598 | VGNC:10650 | OMA, EggNOG |
Mouse | 14226 | Fkbp1b | FK506 binding protein 1b | 10090 | MGI:1336205 | Inparanoid, OMA, EggNOG |
Rat | 58950 | Fkbp1b | FK506 binding protein 1B | 10116 | RGD:61835 | Inparanoid, OMA, EggNOG |
Dog | 612965 | FKBP1B | FK506 binding protein 1B | 9615 | VGNC:54305 | Inparanoid, OMA, EggNOG |
Horse | 100071629 | FKBP1B | FK506 binding protein 1B | 9796 | VGNC:51312 | Inparanoid, OMA, EggNOG |
Cow | 785179 | FKBP1B | FK506 binding protein 1B | 9913 | VGNC:29021 | Inparanoid, OMA, EggNOG |
Opossum | 100014696 | FKBP1B | FK506 binding protein 1B | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100565880 | fkbp1b | FK506 binding protein 1B | 28377 | | Inparanoid, OMA |
Zebrafish | 393785 | fkbp1b | FK506 binding protein 1b | 7955 | ZDB-GENE-040426-1785 | Inparanoid, OMA |
C. elegans | 173160 | fkb-2 | Peptidylprolyl isomerase | 6239 | | Inparanoid, OMA |
S.cerevisiae | 855587 | FPR1 | peptidylprolyl isomerase FPR1 | 4932 | S000005079 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1B
protein /
calcium-binding protein / Peptidyl-prolyl cis-trans isomerase FKBP1B
protein /
chaperone / Peptidyl-prolyl cis-trans isomerase FKBP1B
DTO Classes protein /
Enzyme /
Isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1B
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|