The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
FGF7
Description | Fibroblast growth factor 7 |
---|
Gene and Protein Information
Gene ID | 2252 |
Uniprot Accession IDs | P21781 H0YNY5 Q6FGV5 Q96FG5 FGF-7 |
Ensembl ID | ENSG00000140285 |
Symbol | KGF KGF HBGF-7 |
Chromosome | 15 |
Family | Belongs to the heparin-binding growth factors family. |
Sequence | MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 744975 | FGF7 | fibroblast growth factor 7 | 9598 | VGNC:11889 | OMA, EggNOG |
Macaque | 574345 | FGF7 | fibroblast growth factor 7 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 14178 | Fgf7 | fibroblast growth factor 7 | 10090 | MGI:95521 | Inparanoid, OMA, EggNOG |
Rat | 29348 | Fgf7 | fibroblast growth factor 7 | 10116 | RGD:61805 | Inparanoid, OMA, EggNOG |
Dog | 403915 | FGF7 | fibroblast growth factor 7 | 9615 | VGNC:40853 | Inparanoid, OMA, EggNOG |
Horse | 100033961 | FGF7 | fibroblast growth factor 7 | 9796 | VGNC:18020 | Inparanoid, OMA, EggNOG |
Cow | 616885 | FGF7 | fibroblast growth factor 7 | 9913 | VGNC:28982 | Inparanoid, OMA, EggNOG |
Opossum | 100025923 | FGF7 | fibroblast growth factor 7 | 13616 | | Inparanoid, EggNOG |
Chicken | 415439 | FGF7 | fibroblast growth factor 7 | 9031 | CGNC:66242 | Inparanoid, OMA |
Anole lizard | 100558897 | fgf7 | fibroblast growth factor 7 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 496833 | fgf7 | fibroblast growth factor 7 | 8364 | XB-GENE-488183 | Inparanoid, OMA, EggNOG |
Zebrafish | 493181 | fgf7 | fibroblast growth factor 7 | 7955 | ZDB-GENE-080122-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|