FCGRT

DescriptionIgG receptor FcRn large subunit p51

Gene and Protein Information

Gene ID2217
Uniprot Accession IDs P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn
Ensembl ID ENSG00000104870
Symbol FCRN FCRN alpha-chain
Chromosome19
FamilyBelongs to the immunoglobulin superfamily.
Sequence
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456208FCGRTFc fragment of IgG receptor and transporter9598VGNC:7558Inparanoid, OMA, EggNOG
Macaque718859FCGRTFc fragment of IgG receptor and transporter9544Inparanoid, OMA, EggNOG
Mouse14132FcgrtFc receptor, IgG, alpha chain transporter10090MGI:103017Inparanoid, OMA, EggNOG
Rat29558FcgrtFc fragment of IgG receptor and transporter10116RGD:61811Inparanoid, OMA, EggNOG
Dog476414FCGRTFc fragment of IgG receptor and transporter9615VGNC:40803Inparanoid, OMA, EggNOG
Horse100147583FCGRTFc fragment of IgG receptor and transporter9796VGNC:17976Inparanoid, OMA, EggNOG
Cow338062FCGRTFc fragment of IgG receptor and transporter9913VGNC:28934Inparanoid, OMA, EggNOG
Pig397399FCGRTFc fragment of IgG receptor and transporter9823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography