The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
TNFRSF11B
Description | Tumor necrosis factor receptor superfamily member 11B |
---|
Gene and Protein Information
Gene ID | 4982 |
Uniprot Accession IDs | O00300 B2R9A8 O60236 Q53FX6 Q9UHP4 |
Ensembl ID | ENSG00000164761 |
Symbol | OCIF OPG OPG TR1 OCIF PDB5 |
Chromosome | 8 |
Sequence | MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 464351 | TNFRSF11B | TNF receptor superfamily member 11b | 9598 | VGNC:2999 | OMA, EggNOG |
Macaque | 701850 | TNFRSF11B | TNF receptor superfamily member 11b | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 18383 | Tnfrsf11b | tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) | 10090 | MGI:109587 | Inparanoid, OMA, EggNOG |
Rat | 25341 | Tnfrsf11b | TNF receptor superfamily member 11B | 10116 | RGD:619802 | Inparanoid, OMA, EggNOG |
Dog | 100855848 | TNFRSF11B | TNF receptor superfamily member 11b | 9615 | VGNC:47655 | Inparanoid, OMA, EggNOG |
Horse | 100065885 | TNFRSF11B | TNF receptor superfamily member 11b | 9796 | VGNC:24364 | Inparanoid, OMA, EggNOG |
Cow | 523822 | TNFRSF11B | TNF receptor superfamily member 11b | 9913 | VGNC:36161 | Inparanoid, OMA, EggNOG |
Opossum | 100031818 | TNFRSF11B | TNF receptor superfamily member 11b | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100565448 | tnfrsf11b | TNF receptor superfamily member 11b | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | | TNFRSF11B | TNF receptor superfamily member 11b [Source:HGNC Symbol;Acc:HGNC:11909] | 8364 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|