The store will not work correctly when cookies are disabled.
TACSTD2
Description | Tumor-associated calcium signal transducer 2 |
---|
Gene and Protein Information
Gene ID | 4070 |
Uniprot Accession IDs | P09758 Q15658 Q6FG48 Q7Z7Q4 Q96QD2 |
Ensembl ID | ENSG00000184292 |
Symbol | GA733-1 M1S1 TROP2 EGP1 GP50 M1S1 EGP-1 TROP2 GA7331 GA733-1 |
Chromosome | 1 |
Family | Belongs to the EPCAM family. |
Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 456890 | TACSTD2 | tumor associated calcium signal transducer 2 | 9598 | | OMA, EggNOG |
Macaque | 716334 | TACSTD2 | tumor associated calcium signal transducer 2 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 56753 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10090 | MGI:1861606 | Inparanoid, OMA, EggNOG |
Rat | 494343 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10116 | RGD:1359498 | Inparanoid, OMA, EggNOG |
Cow | 539853 | TACSTD2 | tumor associated calcium signal transducer 2 | 9913 | VGNC:35563 | Inparanoid, OMA, EggNOG |
Pig | 100510966 | TACSTD2 | tumor associated calcium signal transducer 2 | 9823 | | OMA, EggNOG |
Opossum | 100032064 | TACSTD2 | tumor associated calcium signal transducer 2 | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | | TACSTD2 | tumor associated calcium signal transducer 2 [Source:HGNC Symbol;Acc:HGNC:11530] | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 496567 | epcam | epithelial cell adhesion molecule | 8364 | XB-GENE-986667 | OMA, EggNOG |
Zebrafish | 406454 | epcam | epithelial cell adhesion molecule | 7955 | ZDB-GENE-040426-2209 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|