Basic Description

Product Name	Recombinant Human EGF Protein (Biotin)
Synonyms	beta-urogastrone \| EGF \| epidermal growth factor (beta-urogastrone) \| epidermal growth factor \| hEGF \| HOMG4 \| pro-epidermal growth factor \| URG \| Urogastrone \| EGF
Grade	ActiBioPure™, Azide Free, Bioactive
Product Description	Introduction: Epidermal growth factor (EGF) is a hormone that stimulates division of epidermal and other cells. Labeling with biotinylated EGF can be followed by second-step labeling with streptavidin conjugates. Biotinylated EGF has enabled researchers to investigate receptor-membrane interactions, study receptor distribution, calculate rate constants for the interaction of EGF with its receptor, and more. Conjugation: The EGF was conjugated with Biotin under optimum conditions, and unreacted Biotin was removed. Recommended Usage： Fluorescence is typically monitored using a flow cytometer, fluorescence microscope, or fluorimeter. For immunofluorescent staining, the recommended use of this reagent is ≤ 0.5µg per million cells in 100 µl staining volume. It is recommended that the reagent be titrated for optimal performance for different cell lines.
Specifications & Purity	ActiBioPure™, Azide Free, Bioactive
Bioactivity	Binding EGFR
Expression System	Pichia pastoris
Species	Human
Amino Acids	971 - 1021 aa
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Protein Tag	No tag
Conjugation	Biotin
Accession #	P01133

Images

Flow Cytometry: Recombinant Human EGF Protein (Biotin) (rp170191)

Recombinant Human EGF Protein (Biotin) (rp170191) - Flow Cytometry
Flow analysis of EGF receptors (red line) in A431 Cells. Cells were labeled with Recombinant Human EGF Protein (Biotin) (rp170191) at 1/2500 dilution for 1 hour at 4°C, and then incubated with Streptavidin protein (APC) (np169048) at a dilution of 1/400 for 30 minutes at 4°C in the dark. Unlabeled Cells (black line) were used as a negative control.

Product Specifications

Shape	Lyophilized
Reconstitution	This product should be reconstituted in 100μL of deionized water to make a 0.2mg/mL stock solution. Prepare working dilution on day of use. Stock solution is stable for about 8 weeks at 2-8°C as an undiluted liquid. Avoid freeze-thaw cycles. Protect from light.
Storage Temp	Store at 2-8°C,Protected from light
Shipped In	Wet ice
Stability And Storage	The lyophilized products should be stored at –20°C until use. Allow the product to warm to room temperature before opening. Protect from light. When stored properly, the products should be stable for at least 12 months.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot Number	Certificate Type	Date	Item
ZJ23R0700042	Certificate of Analysis	Jul 17, 2023	rp170191

Specifications

Specification Sheet

FAQs and Articles

References

1. Ogiso H, Ishitani R, Nureki O, Fukai S, Yamanaka M, Kim JH, Saito K, Sakamoto A, Inoue M, Shirouzu M et al.. (2002) Crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.. Cell, 110 (6): (775-87). [PMID:12297050] [10.1021/op500134e]
2. Lesuisse D, Mauger J, Nemecek C, Maignan S, Boiziau J, Harlow G, Hittinger A, Ruf S, Strobel H, Nair A, Ritter K, Malleron JL, Dagallier A, El-Ahmad Y, Guilloteau JP, Guizani H, Bouchard H, Venot C.. (2011) Discovery of the first non-ATP competitive IGF-1R kinase inhibitors: advantages in comparison with competitive inhibitors.. Bioorg Med Chem Lett, 21 (8): (2224-2228). [PMID:21441024] [10.1016/j.bmcl.2011.03.003]
3. Gregory, H H and Preston, B M BM.. (1977) The primary structure of human urogastrone.. International journal of peptide and protein research, [PMID:300079]
4. Hommel, U U, Harvey, T S TS, Driscoll, P C PC and Campbell, I D ID.. (1992) Human epidermal growth factor. High resolution solution structure and comparison with human transforming growth factor alpha.. Journal of molecular biology, (5): [PMID:1522591]
5. Furuya, M M, Akashi, S S and Hirayama, K K.. (1989) The primary structure of human EGF produced by genetic engineering, studied by high-performance tandem mass spectrometry.. Biochemical and biophysical research communications, (15): [PMID:2789514]
6. Bell, G I GI and 8 more authors.. (1986) Human epidermal growth factor precursor: cDNA sequence, expression in vitro and gene organization.. Nucleic acids research, (11): [PMID:3491360]
7. Lu, H S HS and 5 more authors.. (2001) Crystal structure of human epidermal growth factor and its dimerization.. The Journal of biological chemistry, (14): [PMID:11438527]
8. Ferguson, Kathryn M KM and 5 more authors.. (2003) EGF activates its receptor by removing interactions that autoinhibit ectodomain dimerization.. Molecular cell, [PMID:12620237]
9. Groenestege, Wouter M Tiel WM and 10 more authors.. (2007) Impaired basolateral sorting of pro-EGF causes isolated recessive renal hypomagnesemia.. The Journal of clinical investigation, [PMID:17671655]
10. Lu, Chafen C and 6 more authors.. (2010) Structural evidence for loose linkage between ligand binding and kinase activation in the epidermal growth factor receptor.. Molecular and cellular biology, [PMID:20837704]
11. Huang, Hsiao-Wen HW, Mohan, Sepuru K SK and Yu, C C.. (2010) The NMR solution structure of human epidermal growth factor (hEGF) at physiological pH and its interactions with suramin.. Biochemical and biophysical research communications, (26): [PMID:21029725]
12. Zettl, Markus M, Adrain, Colin C, Strisovsky, Kvido K, Lastun, Viorica V and Freeman, Matthew M.. (2011) Rhomboid family pseudoproteases use the ER quality control machinery to regulate intercellular signaling.. Cell, (1): [PMID:21439629]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

SKU	Size	Availability	Price	Qty
rp170191-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$599.90
rp170191-20μg	20μg	3	$999.90

Recombinant Human EGF Protein (Biotin)