Basic Description

Product Name	Recombinant Human EGF Protein, ＞95% SDS-PAGE, high purity
Synonyms	beta-urogastrone \| EGF \| epidermal growth factor (beta-urogastrone) \| epidermal growth factor \| hEGF \| HOMG4 \| pro-epidermal growth factor \| URG \| Urogastrone \| EGF
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity	Carrier Free, GMP, Bioactive, ActiBioPure™, High Performance, Animal Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms	EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR
Purity	＞95% SDS-PAGE
Bioactivity	Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9 ng/mL.
Endotoxin Concentration	<0.2 EU/μg
Expression System	Pichia pastoris
Species	Human
Amino Acids	971-1021 aa
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Protein Tag	No tag
Protein Length	Full length protein
Accession #	P01133
Source	Recombinant
Predicted molecular weight	6 kDa

Images

Protein Bioactivity: Recombinant Human EGF Protein (rp145392)

Recombinant Human EGF Protein (rp145392)-Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9ng/mL.

SDS-PAGE: Recombinant Human EGF Protein (rp145392)

Recombinant Human EGF Protein (rp145392)-SDS-PAGE
5μg/lane of Recombinant Human EGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 6.6 kDa.

Product Specifications

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile 10mM PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 ℃. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at 2-8℃ short term (4 weeks). Store at -20℃ long term (24 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
CAS	62253-63-8

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0400094	Certificate of Analysis	Apr 25, 2023	rp145392
ZJ23F0400095	Certificate of Analysis	Apr 25, 2023	rp145392
ZJ23F0400093	Certificate of Analysis	Apr 19, 2023	rp145392

Safety and Hazards(GHS)

Pictogram(s)	GHS07
Signal	Warning
Hazard Statements	H315:Causes skin irritation H319:Causes serious eye irritation H335:May cause respiratory irritation
Precautionary Statements	P261:Avoid breathing dust/fume/gas/mist/vapors/spray. P305+P351+P338:IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do - continue rinsing. P280:Wear protective gloves/protective clothing/eye protection/face protection. P302+P352:IF ON SKIN: wash with plenty of water. P321:Specific treatment (see ... on this label). P405:Store locked up. P501:Dispose of contents/container to ... P264:Wash hands [and …] thoroughly after handling. P271:Use only outdoors or in a well-ventilated area. P304+P340:IF INHALED: Remove person to fresh air and keep comfortable for breathing. P403+P233:Store in a well-ventilated place. Keep container tightly closed. P362+P364:Take off contaminated clothing and wash it before reuse. P264+P265:Wash hands [and …] thoroughly after handling. Do not touch eyes. P337+P317:If eye irritation persists: Get medical help. P332+P317:If skin irritation occurs: Get medical help. P319:Get medical help if you feel unwell.
WGK Germany	3

Specifications

Specification Sheet

FAQs and Articles

Citations of This Product

How to Cite Aladdin Scientific Products?

1. Xiaoli Lu, Shangwen Sun, Na Li, Shuying Hu, Yuyao Pan, Lin Wang, Xuefeng Zhou, Hanbang Chen, Feimin Zhang. (2024) Janus sponge/electrospun fibre composite combined with EGF/bFGF/CHX promotes reconstruction in oral tissue regeneration. COLLOIDS AND SURFACES B-BIOINTERFACES, 243 (114117). [PMID:39084056] [10.1016/j.colsurfb.2024.114117]

References

1. Ogiso H, Ishitani R, Nureki O, Fukai S, Yamanaka M, Kim JH, Saito K, Sakamoto A, Inoue M, Shirouzu M et al.. (2002) Crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.. Cell, 110 (6): (775-87). [PMID:12297050] [10.1021/op500134e]
2. Feng Y, Yin Y, Weiser A, Griffin E, Cameron MD, Lin L, Ruiz C, Schürer SC, Inoue T, Rao PV, Schröter T, Lograsso P.. (2008) Discovery of substituted 4-(pyrazol-4-yl)-phenylbenzodioxane-2-carboxamides as potent and highly selective Rho kinase (ROCK-II) inhibitors.. J Med Chem, 51 (21): (6642-6645). [PMID:18834107] [10.1021/jm800986w]
3. Lesuisse D, Mauger J, Nemecek C, Maignan S, Boiziau J, Harlow G, Hittinger A, Ruf S, Strobel H, Nair A, Ritter K, Malleron JL, Dagallier A, El-Ahmad Y, Guilloteau JP, Guizani H, Bouchard H, Venot C.. (2011) Discovery of the first non-ATP competitive IGF-1R kinase inhibitors: advantages in comparison with competitive inhibitors.. Bioorg Med Chem Lett, 21 (8): (2224-2228). [PMID:21441024] [10.1016/j.bmcl.2011.03.003]
4. Hodgetts KJ, Ge P, Yoon T, De Lombaert S, Brodbeck R, Gulianello M, Kieltyka A, Horvath RF, Kehne JH, Krause JE, Maynard GD, Hoffman D, Lee Y, Fung L, Doller D.. (2011) Discovery of N-(1-ethylpropyl)-[3-methoxy-5-(2-methoxy-4-trifluoromethoxyphenyl)-6-methyl-pyrazin-2-yl]amine 59 (NGD 98-2): an orally active corticotropin releasing factor-1 (CRF-1) receptor antagonist.. J Med Chem, 54 (12): (4187-4206). [PMID:21618986] [10.1021/jm200365y]
5. Gregory, H H and Preston, B M BM.. (1977) The primary structure of human urogastrone.. International journal of peptide and protein research, [PMID:300079]
6. Hommel, U U, Harvey, T S TS, Driscoll, P C PC and Campbell, I D ID.. (1992) Human epidermal growth factor. High resolution solution structure and comparison with human transforming growth factor alpha.. Journal of molecular biology, (5): [PMID:1522591]
7. Furuya, M M, Akashi, S S and Hirayama, K K.. (1989) The primary structure of human EGF produced by genetic engineering, studied by high-performance tandem mass spectrometry.. Biochemical and biophysical research communications, (15): [PMID:2789514]
8. Bell, G I GI and 8 more authors.. (1986) Human epidermal growth factor precursor: cDNA sequence, expression in vitro and gene organization.. Nucleic acids research, (11): [PMID:3491360]
9. Lu, H S HS and 5 more authors.. (2001) Crystal structure of human epidermal growth factor and its dimerization.. The Journal of biological chemistry, (14): [PMID:11438527]
10. Ferguson, Kathryn M KM and 5 more authors.. (2003) EGF activates its receptor by removing interactions that autoinhibit ectodomain dimerization.. Molecular cell, [PMID:12620237]
11. Hillier, Ladeana W LW and 121 more authors.. (2005) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.. Nature, (7): [PMID:15815621]
12. Groenestege, Wouter M Tiel WM and 10 more authors.. (2007) Impaired basolateral sorting of pro-EGF causes isolated recessive renal hypomagnesemia.. The Journal of clinical investigation, [PMID:17671655]
13. Lu, Chafen C and 6 more authors.. (2010) Structural evidence for loose linkage between ligand binding and kinase activation in the epidermal growth factor receptor.. Molecular and cellular biology, [PMID:20837704]
14. Huang, Hsiao-Wen HW, Mohan, Sepuru K SK and Yu, C C.. (2010) The NMR solution structure of human epidermal growth factor (hEGF) at physiological pH and its interactions with suramin.. Biochemical and biophysical research communications, (26): [PMID:21029725]
15. Zettl, Markus M, Adrain, Colin C, Strisovsky, Kvido K, Lastun, Viorica V and Freeman, Matthew M.. (2011) Rhomboid family pseudoproteases use the ER quality control machinery to regulate intercellular signaling.. Cell, (1): [PMID:21439629]
16. Xiaoli Lu, Shangwen Sun, Na Li, Shuying Hu, Yuyao Pan, Lin Wang, Xuefeng Zhou, Hanbang Chen, Feimin Zhang. (2024) Janus sponge/electrospun fibre composite combined with EGF/bFGF/CHX promotes reconstruction in oral tissue regeneration. COLLOIDS AND SURFACES B-BIOINTERFACES, 243 (114117). [PMID:39084056] [10.1016/j.colsurfb.2024.114117]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

SKU	Size	Availability	Price
rp145392-100μg	100μg	7	$69.90
rp145392-1mg	1mg	8	$399.90
rp145392-500μg	500μg	10	$299.90

Recombinant Human EGF Protein, ＞95% SDS-PAGE, high purity