Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp156332-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $56.90 | |
rp156332-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
rp156332-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
rp156332-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $213.90 |
Carrier Free, ≥90% (SDS-PAGE), Active, E. coli, No tag, 49-118 aa
Product Name | Recombinant Human IGF-I/IGF-1 Protein |
---|---|
Synonyms | IBP1 | IGF1 | IGF-1 | IGF1A | IGFI | IGF-I | IGF-IA | IGF-IB | insulin-like growth factor 1 (somatomedin C) | insulin-like growth factor 1 | insulin-like growth factor I | insulin-like growth factor IA | insulin-like growth factor IB | Mechano growth fact |
Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
Specifications & Purity | Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), See COA |
Biochemical and Physiological Mechanisms | Insulin-like growth factor 1 (IGF-1 or IGF-I), also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Human IGF-1 is synthesized as two precursor isoforms with N- and alternate Cterminal prop |
Bioactivity | Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 28.6 ng/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Amino Acids | 49-118 aa |
Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Accession # | P05019 |
Predicted molecular weight | 7.7 kDa |
SDS-PAGE | 10.2 & 13.8 kDa, under reducing conditions; 10.4 & 13.8 & 20.9 kDa, under non-reducing conditions. |
Recombinant Human IGF-I/IGF-1 Protein (rp156332) - Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 28.6 ng/mL.
Recombinant Human IGF-I/IGF-1 Protein (rp156332) - SDS-PAGE
3 μg/lane of Recombinant Human IGF-I/IGF-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.2 & 13.8 kDa under reducing conditions and 10.4 & 13.8 & 20.9 kDa under non-reducing conditions.
IGF-I/IGF-1 can form oligomers under certain conditions (PMID: 11551198).
Concentration | See COA |
---|---|
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Starting at $79.90
Starting at $99.90