Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp166305-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
rp166305-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $149.90 | |
rp166305-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $899.90 |
GMP, ≥98% (SDS-PAGE&SEC-HPLC), Active, E. coli, C-His, 49-118 aa (E51R)
Product Name | Recombinant Human LR3 IGF-I/IGF-1 Protein |
---|---|
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance, sterile |
Specifications & Purity | Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High Performance, sterile, ≥98%(SDS-PAGE&HPLC) |
Biochemical and Physiological Mechanisms | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthe |
Bioactivity | Measured in a cell proliferation assay using human MCF7 cells. The ED50 for this effect is < 5 ng/mL. The corresponding specific activity is>2×10^5 IU/mg. |
Endotoxin Concentration | <0.01 EU/μg |
Amino Acids | 49-118 aa (E51R) |
Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAHHHHHH |
Accession # | P05019 |
Predicted molecular weight | 9.1 kDa |
SDS-PAGE | 9.1 kDa |
Reconstitution | Reconstitute in water to a concentration of 1 mg/mL, for other concentrations, please adjust the concentration of phosphate in the solution by yourself. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20℃~-80℃ long term (60 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Starting at $56.90
Starting at $79.90